This is a working overview of tuftsin, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-10-06 and is reviewed periodically as new material appears.
Regulatory status differs sharply by region. Selank holds a Russian marketing authorization, where it is supplied mainly as nasal drops, while authorities elsewhere have not approved it for medical use. Material sold internationally is therefore usually labeled as a research chemical rather than a medicine. Peer-reviewed publications come predominantly from Russian laboratories, and sample sizes are generally small. Whether the compound produces comparable effects under independent, well-controlled replication remains an open question that the broader literature has not settled.
Selank is a synthetic heptapeptide developed in Russia as a structural analogue of tuftsin, a naturally occurring immunomodulatory tetrapeptide. Its sequence, Thr-Lys-Pro-Arg-Pro-Gly-Pro, keeps the tuftsin core at the N-terminus and appends a Pro-Gly-Pro tail. Researchers at the Institute of Molecular Genetics in Moscow synthesized the compound during the 1990s while searching for peptides with combined anxiolytic and immunomodulatory activity. The added tail was intended to resist enzymatic cleavage and prolong the molecule's presence in circulation.
Solubility behavior is a practical concern for handling. Selank dissolves readily in water and in common aqueous buffers, which simplifies preparation of working solutions. The choice of solvent, ionic strength, and pH can influence aggregation over time, particularly at higher concentrations. Aqueous solutions are typically sterile-filtered before use. Because stability depends on several variables, storage and handling notes should be treated as general guidance rather than fixed rules, and specific values are best confirmed against a certificate of analysis for each batch.
Characterization of Selank in a laboratory setting relies on standard peptide methods. Reverse-phase high-performance liquid chromatography separates the target from related impurities and provides a purity figure, commonly reported as 95 percent or higher. Mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, confirms the molecular mass and helps detect truncation or modification. Amino acid analysis can verify composition when a sequence-level check is needed. These techniques together establish identity and purity for a given lot.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic heptapeptide | Analog of the tetrapeptide tuftsin |
| Sequence | Thr-Lys-Pro-Arg-Pro-Gly-Pro | Reported consistently across pharmacopoeial descriptions |
| Appearance | White to off-white lyophilized powder | Typical form of research-grade material |
| Solubility | Freely soluble in water | Aqueous buffers; poor in nonpolar solvents |
| Typical storage temperature | -20 degrees Celsius | Lyophilized powder; protect from moisture |
Peptide stability depends strongly on temperature, moisture, and pH. Lyophilized Selank is generally most stable when stored cold and dry, with freezer temperatures commonly used for long-term storage. In solution, the compound is susceptible to hydrolysis and to microbial growth if it is not handled aseptically. The C-terminal proline-rich extension appears to slow enzymatic cleavage relative to tuftsin, though quantitative degradation rates vary with the matrix and the conditions tested. Published stability data specific to Selank remain sparse.
Quality assessment of Selank samples typically combines purity determination with identity confirmation and counter-ion analysis. Purity is usually reported as a percentage by chromatographic area, with values above 95 percent often quoted for research-grade material. Water content and residual solvents are checked in lyophilized batches because they affect both stability and accurate mass determination. A reported purity figure does not by itself establish that a sample is the intended sequence, so orthogonal methods are needed to rule out sequence isomers or truncation products.
Characterization of Selank in laboratory settings relies on standard peptide analytical techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and degradation products, while mass spectrometry confirms molecular identity through accurate mass measurement. Amino acid analysis and peptide sequencing verify the primary structure when reference material is unavailable. Because Selank is a short chain, fragmentation-based analysis produces a diagnostic ion pattern that supports confident identification.
Tuftsin, the parent structure, is a naturally occurring immunomodulatory tetrapeptide released from the Fc region of immunoglobulin G by spleen enzymes. Selank extends this four-residue sequence with three additional amino acids. The stated rationale is that the added tail slows enzymatic breakdown and may influence receptor interactions. How the full heptapeptide behaves at the molecular level is not firmly established, and proposed mechanisms often involve indirect modulation of neurotransmitter or immune signaling rather than a single defined target.
Selank is a synthetic heptapeptide developed in Russia. Its sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, a seven-residue chain built around the natural tetrapeptide tuftsin. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences first described the compound in the mid-1990s. The design combined the tuftsin core with an added Pro-Gly-Pro tail, a modification intended to extend the molecule's stability in biological fluids. Published work on the peptide has appeared mainly in Russian-language journals.
Naming conventions place Selank in the same research family as Semax, another Russian-developed peptide investigated for cognitive effects. The two compounds share a lineage but differ in sequence and in the biological systems proposed as their targets. Semax descends from ACTH fragments, whereas Selank descends from tuftsin. Publications sometimes identify Selank by its full peptide sequence or by laboratory codes rather than one uniform trade name. Because replication outside Russia is limited, reports on its properties are best read alongside the study design and the purity of the material tested.
Selank is a synthetic heptapeptide developed in Russia during the 1990s. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences designed it as a stabilized analog of tuftsin, a naturally occurring immunomodulatory tetrapeptide. The compound has been studied primarily for its reported anxiolytic and nootropic effects. It remains largely unknown in Western pharmacology and is not approved as a medicine by major regulators such as the FDA or the EMA.
Outside its country of origin the compound is generally handled as a research chemical rather than an approved medicine. No regulatory approval from the United States Food and Drug Administration or the European Medicines Agency has been granted for human use. Identity and purity are normally checked by reverse-phase high-performance liquid chromatography, with mass spectrometry used to confirm the molecular mass. Lyophilised material is stored cold and desiccated, and repeated freeze-thaw cycles are avoided.
Published work on this peptide almost always uses intranasal delivery, with drops or a spray applied to the nasal mucosa. Some animal experiments have used subcutaneous or intraperitoneal injection, and a smaller number have compared routes directly. Oral administration is not a focus of the literature, because short peptides of this size are broken down by digestive enzymes and cross intestinal barriers poorly. How much of an intranasal dose reaches the bloodstream intact in humans remains an open question.
Animal studies have examined behaviour in tests of anxiety, memory retention and stress response, and several report changes in neurotrophic or neurotransmitter-related markers. The human evidence base is much smaller, consisting mainly of short trials conducted in Russia with limited reporting in English-language journals. Sample sizes are modest and outcome measures vary between studies, so the findings are best described as preliminary. Independent replication under modern trial standards has not been widely reported.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Mahathir met his wife, Siti Hasmah, during their medical studies, and they married in 1956. They had four biological children—Marina, Mirzan, Mokhzani, and Mukhriz—and later adopted three more—Melinda, Maizura, and Mazhar. In 2021, they celebrated their 65th wedding anniversary. His granddaughter, Ineza, has described him as a family-oriented man who enjoys spending time with his grandchildren. Siti Hasmah died on 28 September 2026, aged 100. Mahathir is widely known for his workaholic nature. Despite his demanding schedule, he enjoys simple pleasures such as cooking and driving his family to restaurants. He is also a fan of the song "My Way" and owns a stable of horses, most of which were gifted to him. His childhood home in Alor Setar, named Rumah Kelahiran Mahathir Mohamad, was restored and opened to the public in 1992, showcasing personal memorabilia from his early life. Despite his longevity, Mahathir had experienced a range of health problems over the decades, some of them serious. These included heart conditions and chest infections that led to repeated hospitalisations and several surgical procedures, including two coronary artery bypass operations. He had also been a target of security threats during his political career and especially during his premiership, though none have caused him serious harm. Mahathir neither drinks alcohol nor smokes. On 10 July 2025, he celebrated his 100th birthday by making a special live podcast at his office in Putrajaya. He described his centennial as being a "normal day".
== Removal == This overarching process, which has come to be known simply as virus removal, is one in which all of the viruses in a given sample are removed by traditional extraction or [full energy] methods. Some of the more prominent methods include:
== Legal status == In the United States, chloral hydrate is a schedule IV controlled substance and requires a physician's prescription. Its properties have sometimes led to its use as a date rape drug. The phrase, "slipping a mickey," originally referred specifically to adding chloral hydrate to a person's (alcoholic) drink without the person's knowledge.
87Rb, 187Re, 176Lu, 232Th, and 238U have half-lives long enough that their decay is limited over geological time scales; 40K and 235U have shorter half-lives and are hence severely depleted, but are still long-lived enough to remain present in significant amount on Earth. The longest-lived isotope not proven to be primordial is 146Sm, which has a half-life of 9.20×107 years, followed by 244Pu (8.13×107 years) and 92Nb (3.47×107 years). 244Pu was reported to exist in nature as a primordial nuclide in 1971, but this detection could not be confirmed by further studies in 2012 and 2022. Taking into account that all these nuclides must exist for at least 4.58×109 years, 146Sm must survive 50 half-lives (and hence be reduced by 250 ≈ 1×1015), 244Pu must survive 57 (and be reduced by a factor of 257 ≈ 1×1017), and 92Nb must survive 130 (and be reduced by 2130 ≈ 1×1039). Mathematically, considering the likely initial abundances of these nuclides, primordial 146Sm and 244Pu should persist somewhere within the Earth today, even if they are not identifiable in the relatively minor portion of the Earth's crust available to human assays, while 92Nb and all shorter-lived nuclides should not. Nuclides such as 92Nb that were present in the primordial solar nebula but have long since decayed away completely are termed extinct radionuclides if they have no other means of being regenerated. As for 244Pu, calculations suggest that as of 2022, sensitivity limits were about one order of magnitude away from detecting it as a primordial nuclide.
Sources: en.wikipedia.org
Regular insulin, also known as neutral insulin and soluble insulin, is a type of short-acting medical insulin. It is used to treat type 1 diabetes, type 2 diabetes, gestational diabetes, and complications of diabetes such as diabetic ketoacidosis and hyperosmolar hyperglycemic states. It is also used along with glucose to treat high blood potassium levels. Typically it is given by injection under the skin, but may also be used by injection into a vein or muscle. Onset of effect is typically in 30 minutes and it typically lasts for 8 hours. The common side effect is low blood sugar. Other side effects may include pain or skin changes at the sites of injection, low blood potassium, and allergic reactions. Use during pregnancy is relatively safe for the baby. Regular insulin can be made from the pancreas of pigs or cows. Human versions can be made either by modifying pig versions or recombinant technology. Insulin was first used as a medication in Canada by Charles Best and Frederick Banting in 1922. It is on the World Health Organization's List of Essential Medicines. In 2017, it was the 209th most commonly prescribed medication in the United States, with more than 2 million prescriptions. Versions are also available mixed with longer-acting versions of insulin, such as NPH insulin. In 2020, the combination of human insulin with insulin isophane was the 246th most commonly prescribed medication in the United States, with more than 2 million prescriptions.
==== Laboratory ==== Lysergic acid is generally produced by hydrolysis of natural lysergamides, but can also be synthesized in the laboratory by a complex total synthesis, for example by Robert Burns Woodward's team in 1956. An enantioselective total synthesis based on a palladium-catalyzed domino cyclization reaction has been described in 2011 by Fujii and Ohno. Lysergic acid monohydrate crystallizes in very thin hexagonal leaflets when recrystallized from water. Lysergic acid monohydrate, when dried (140 °C at 2 mmHg or 270 Pa) forms anhydrous lysergic acid.
Equilibrium chemistry is concerned with systems in chemical equilibrium. The unifying principle is that the free energy of a system at equilibrium is the minimum possible, so that the slope of the free energy with respect to the reaction coordinate is zero. This principle, applied to mixtures at equilibrium provides a definition of an equilibrium constant. Applications include acid–base, host–guest, metal–complex, solubility, partition, chromatography and redox equilibria.
=== Terry "Motor Mouth" Young's suspension === In July 1982, "Valley Girl" was stunted over Philadelphia's "Hot Hits" formatted station WCAU-FM for a short period of time during Terry "Motor Mouth" Young's evening shift on the station (7:00–8:00 PM Eastern). Young was the most popular radio disc jockey (DJ) in all of the Philadelphia radio market at the time. The song was played around ten consecutive times without any commercial interruptions, despite a weather forecast being simulated by Terry himself before sneakily playing the song again. Apparently drowsy after the final play, Terry drunkenly commented on the wrong song ("Abracadabra" by the Steve Miller Band) before the station manager entered the studio and angrily intervened, telling Young to "get out and stay out" before shutting the door on him. Young received a brief suspension from the station, but returned to the studio soon afterward and stayed for four more years until 1986.
Sources: en.wikipedia.org
Selank is a synthetic seven-amino-acid peptide modeled on tuftsin, a fragment of the immunoglobulin G heavy chain. It was designed in Russia to combine anxiolytic and immunomodulatory properties in one molecule.
The first four residues of Selank reproduce the tuftsin sequence Thr-Lys-Pro-Arg. A Pro-Gly-Pro extension at the C-terminus was added to slow enzymatic breakdown and extend residence time.
It holds marketing authorization in Russia, where nasal drop formulations are sold. No equivalent approval exists in the European Union, the United States, or most other countries.
Reverse-phase HPLC is the usual method and gives a percentage purity value. Mass spectrometry then confirms the molecular mass. Together they provide a basic identity and purity profile for a lot.